], ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { "event" : "kudoEntity", { "action" : "rerender" "truncateBodyRetainsHtml" : "false", "quiltName" : "ForumMessage", { "context" : "", ] logmein: [76, 79, 71, 77, 69, 73, 78], } "useSubjectIcons" : "true", "forceSearchRequestParameterForBlurbBuilder" : "false", "action" : "rerender" So bleibst Du mit allem, was Dir wichtig ist, verbunden. "context" : "envParam:quiltName", }, Du hast versehentlich Dein eSIM-Profil gelöscht? "context" : "envParam:quiltName", "eventActions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", } ] //resetMenu(); var keycodes = { var neededkeys = [76, 79, 71, 77, 69, 73, 78]; LITHIUM.AjaxSupport.ComponentEvents.set({ } "actions" : [ "event" : "editProductMessage", }, { Buy it now online and get free delivery. "useSimpleView" : "false", { }, $('#node-menu li.has-sub>a').on('click', function(){ } "useCountToKudo" : "false", }, } "context" : "envParam:quiltName,message", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ', 'ajax'); "accessibility" : false, { ] } "dialogKey" : "dialogKey" .attr('aria-selected','true'); "action" : "rerender" //resetMenu(); ] "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", { { if ( key == neededkeys[0] ) { "actions" : [ { "actions" : [ }, } "action" : "rerender" "action" : "rerender" //$('#lia-body').addClass('lia-window-scroll'); "disableKudosForAnonUser" : "false", { "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" ] ;(function($) { { "parameters" : { "event" : "markAsSpamWithoutRedirect", "context" : "envParam:quiltName,expandedQuiltName", "event" : "addThreadUserEmailSubscription", ] { "disableLinks" : "false", "actions" : [ "context" : "envParam:quiltName", } "action" : "rerender" { ] } "includeRepliesModerationState" : "false", "action" : "rerender" Das heißt eingebaut. "action" : "rerender" "}); "actions" : [ "event" : "deleteMessage", } // If watching, pay attention to key presses, looking for right sequence. ] "initiatorDataMatcher" : "data-lia-kudos-id" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2228045 .lia-rating-control-passive', '#form_2'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "context" : "", ] })(LITHIUM.jQuery); "event" : "AcceptSolutionAction", } Ein eSIM-fähiges Gerät z.B. { "event" : "deleteMessage", "event" : "kudoEntity", { } //$('#vodafone-community-header').css('display','block'); { "; { "truncateBody" : "true", }, "event" : "markAsSpamWithoutRedirect", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "event" : "addThreadUserEmailSubscription", window.scrollTo(0,position_x.top - 150); "action" : "addClassName" }, "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "editProductMessage", ] } "initiatorDataMatcher" : "data-lia-message-uid" "context" : "envParam:quiltName,expandedQuiltName", Vertrag dazu buchen. "includeRepliesModerationState" : "false", "actions" : [ "action" : "rerender" { "event" : "RevokeSolutionAction", }, "actions" : [ { ] "parameters" : { "showCountOnly" : "false", Bei Vodafone bekommt man alle Vodafone RED Tarife derzeit auch als eSIM Variante und kann daher die normalen Handytarife und Flatrates des Unternehmens auch für eSIM fähige Handys und Smartphones buchen. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); { LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "context" : "", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'dMQ-KRTs7SkFeLZjXN6lj0wwfV2MKqziKHIGeVtE56c. '; "actions" : [ { ] { $('#custom-overall-notif-count').html(notifCount); ] element.siblings('li').find('li').removeClass('active'); "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); ] ;(function($){ "event" : "QuickReply", "action" : "rerender" "context" : "", "context" : "", { ] { { "actions" : [ "context" : "", "truncateBodyRetainsHtml" : "false", ] }, } } { ] }, "context" : "envParam:entity", "action" : "rerender" } "useTruncatedSubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", count = 0; Vodafone Callya ohne eSIM Unterstützung. "actions" : [ { "context" : "", "eventActions" : [ "action" : "rerender" }, }); { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'CFFVlfQSGGa0aoO2vZBFWJNl6uqfkb823x1enE-uhpI. "actions" : [ "action" : "pulsate" "useTruncatedSubject" : "true", return; "event" : "removeMessageUserEmailSubscription", { eSIM statt physische SIM-Karte - kostenlos oder ni... Diesen Thema für aktuellen Benutzer floaten, Dem ist nichts weiter hinzuzufügen, perfekte Erklärung, Selfservice-MeinVodafone-App-Quick-Check-Verbrauchsabfrage. Die Community hilft!#bleibtgesund, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_2061f642ddacf3', 'disableAutoComplete', '#ajaxfeedback_2061f642b8b504_0', 'LITHIUM:ajaxError', {}, 'Iukwgv4w-iAT0_k0kR_Thk0OY9b6GIBv3eHGwsvBhr4. } { ] })(LITHIUM.jQuery); "action" : "rerender" "message" : "2225865", "eventActions" : [ "eventActions" : [ "initiatorBinding" : true, "useSubjectIcons" : "true", { "forceSearchRequestParameterForBlurbBuilder" : "false", Vielen Dank! "event" : "ProductMessageEdit", "actions" : [ "disableKudosForAnonUser" : "false", "context" : "", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "kudosLinksDisabled" : "false", }, LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-message-uid" "eventActions" : [ } "kudosable" : "true", "truncateBodyRetainsHtml" : "false", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/2001/thread-id/239367","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Xulihd0J8e1TjMdmcHvH8HomrVwlgQKV6MlftwzR3Ck. Jede weitere digitale Karte kostet 3,95 Euro pro Monat. { "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", .attr('aria-hidden','false') LITHIUM.Auth.CHECK_SESSION_TOKEN = 'YBCw5kXrLyvVZbVfznr8-YCiEOhdBQUyqtSd8Z8aiyY. { "initiatorBinding" : true, "actions" : [ "actions" : [ "action" : "pulsate" "truncateBodyRetainsHtml" : "false", "linkDisabled" : "false" { "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "action" : "rerender" "useTruncatedSubject" : "true", "linkDisabled" : "false" { "event" : "removeMessageUserEmailSubscription", Das geht auch: Du tauschst einfach Deine Karte im Shop oder über die 1212 in eine eSIM. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "disallowZeroCount" : "false", "context" : "envParam:entity", "messageViewOptions" : "1111110111111111111110111110100101001101" { ] "disallowZeroCount" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2225865 .lia-rating-control-passive', '#form_0'); "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetEditCommentForm", }, "action" : "rerender" { "parameters" : { "includeRepliesModerationState" : "false", { }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_17","feedbackSelector":".InfoMessage"}); } "kudosable" : "true", } { }, } }, { Wichtig: Wir können Dir auf Dein Feedback nicht antworten! }, }, Bei allen Netzanbietern, die eSIM unterstützen. } logmein: [76, 79, 71, 77, 69, 73, 78], }, "showCountOnly" : "false", { { "action" : "addClassName" LITHIUM.AjaxSupport.ComponentEvents.set({ }, Und wenn ja, kostenlos? "initiatorBinding" : true, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2225805 .lia-rating-control-passive', '#form'); { "dialogKey" : "dialogKey" } Achte darauf, dass Dein eSIM-Gerät eine Internet-Verbindung hat, z.B. { How to use dual sim in iphone 11 and iphone 11 pro setup esim. ] "context" : "", "event" : "RevokeSolutionAction", { { }); if ( neededkeys[count] == key ) { "initiatorDataMatcher" : "data-lia-message-uid" }, "action" : "rerender" "actions" : [ "actions" : [ } "actions" : [ }, "componentId" : "kudos.widget.button", "action" : "rerender" { "context" : "", Schnell und einfach geht es über den Vodafone-Kundendienst. } "context" : "lia-deleted-state", { { element.siblings('li').find('ul').slideUp(); $('#vodafone-community-header .lia-search-toggle').click(function() { }, $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "action" : "rerender" "initiatorBinding" : true, { "context" : "envParam:feedbackData", "actions" : [ } "context" : "", "event" : "unapproveMessage", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); { { { "event" : "MessagesWidgetEditAnswerForm", } { { $('section.header-announcement').slideUp(); } ] { { "message" : "2225805", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] return; ] "event" : "ProductAnswerComment", { }, ] "event" : "approveMessage", ] "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "actions" : [ "context" : "", "action" : "rerender" } "forceSearchRequestParameterForBlurbBuilder" : "false", })(LITHIUM.jQuery); { } { Du kannst das AutoLogin Die eSIM erhalten Sie immer kostenlos zu Ihrem Tarif dazu und … return; ] ] { "disableLabelLinks" : "false", man kann in den USA beide zusammen betreiben oder eine deaktiveren ( das haben wir mit unser vodafone esim gemacht). }, ] "initiatorBinding" : true, } else { } }, { "action" : "rerender" "event" : "removeThreadUserEmailSubscription", }, ], LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "event" : "MessagesWidgetCommentForm", LITHIUM.Dialog.options['1118307015'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.Loader.runJsAttached(); } lithadmin: [] "actions" : [ "event" : "MessagesWidgetMessageEdit", Bist du sicher, dass du fortfahren möchtest? /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "activecastFullscreen" : false, "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "actions" : [ "actions" : [ }, $(event.data.selector).removeClass('cssmenu-open'); }, "eventActions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2228045 .lia-rating-control-passive', '#form_2'); } Positiv ist, das ein einmal erstelltes eSIM-Profil mehrmals genutzt werden kann. ] } { } "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] Wenn die bestehende Festnetznummer dauerhaft erhalten bleiben … "event" : "removeThreadUserEmailSubscription", LITHIUM.AjaxSupport.useTickets = false; "disableKudosForAnonUser" : "false", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'CFFVlfQSGGa0aoO2vZBFWJNl6uqfkb823x1enE-uhpI. "event" : "AcceptSolutionAction", "action" : "rerender" $('.css-menu').removeClass('cssmenu-open') "event" : "ProductAnswerComment", var msg = $(".message-uid-2228045"); "event" : "MessagesWidgetEditAction", var keycodes = { { "disableLabelLinks" : "false", "event" : "kudoEntity", Die Kosten liegen dann bei 5 Euro für eine MultiSIM für einen normalen Vodafone RED Tarif. "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2228045 .lia-rating-control-passive', '#form_2'); } "context" : "", "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "actions" : [ ] "defaultAriaLabel" : "", }); ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); })(LITHIUM.jQuery); nutzen, Mehr }, } ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "event" : "addMessageUserEmailSubscription", Das lässt keine weiteren Fragen offen. { "event" : "QuickReply", "componentId" : "kudos.widget.button", { "action" : "rerender" "context" : "", } "event" : "MessagesWidgetEditAction", ] "initiatorBinding" : true, Kostenlose amazon kreditkarte mit 40 startguthaben. { "context" : "", Kann ich meinen Aktivierungscode nochmal nutzen, um ein neues Gerät zu verbinden? { }); "context" : "", "action" : "rerender" else { { Eine aktive Internet-Verbindung über Mobilfunk oder WLAN. } }, Rajaton netti – (vastaanotto 0,128 Mbit/s / lähetys 0,128 Mbit/s) ja 300 viestiä Suomessa kolmeksi … "actions" : [ "displayStyle" : "horizontal", ] LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } }); ] "action" : "pulsate" "context" : "", }, { }, })(LITHIUM.jQuery); "actions" : [ // Set start to true only if the first key in the sequence is pressed "action" : "rerender" { "initiatorBinding" : true, } })(LITHIUM.jQuery); // Pull in global jQuery reference { } } LITHIUM.Dialog.options['1841927551'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2228045 .lia-rating-control-passive', '#form_2'); Callya Digital – kostenlose Sim von Vodafone mit 10GB Volumen und Allnet Flat – Vodafone hat die eigenen Callya Freikarten schon immer mit sehr interessanten Neuerungen ausgestattet (beispielsweise als einer der ersten Anbieter mit schnellem LTE) und mit Callya Digital setzt das Unternehmen diesen Weg fort. }); ] Allerdings bietet der Provider zum Start erst einmal nur die Galaxy Watch von Samsung sowie das iPad Pro 2018 mit eSIM an. "context" : "", { }, { }, } //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "actions" : [ }); Prüf bitte zuerst, ob Du diese Voraussetzung erfüllst: Gut zu wissen: Du findest Deine 6-stellige ePIN auch in MeinVodafone. }, ] "message" : "2228045", //$('#community-menu-toggle').removeClass('active') Diesen erreichen Sie 24 Stunden an 7 Tagen die Woche unter der Nummer 0172/2290229. Schreib es uns. }, } "displayStyle" : "horizontal", Wähl die eSIM direkt als Hauptkarte: bei einem neuen Vertrag oder einer Vertragsverlängerung. })(LITHIUM.jQuery); }, { "actions" : [ } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { }, { ] "action" : "pulsate" "context" : "", ] })(LITHIUM.jQuery); // Pull in global jQuery reference "action" : "rerender" "actions" : [ "componentId" : "forums.widget.message-view", }, "context" : "envParam:entity", "context" : "", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ { "selector" : "#messageview_1", var count = 0; "initiatorDataMatcher" : "data-lia-kudos-id" "event" : "MessagesWidgetCommentForm", "action" : "rerender" "message" : "2228045", }, { "forceSearchRequestParameterForBlurbBuilder" : "false", Starte dann den Download noch einmal. } else { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2225865,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] var key = e.keyCode; } "context" : "", "action" : "rerender" "displaySubject" : "true", } "action" : "rerender" LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234545}); // Oops, not the right sequence, lets restart from the top. "actions" : [ "action" : "rerender" lithstudio: [], ] count = 0; "action" : "rerender" ;(function($){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] "event" : "approveMessage", } Tausch sie in eine eSIM in MeinVodafone > Neue SIM-Karte. }, }); "event" : "RevokeSolutionAction", "actions" : [ "context" : "envParam:selectedMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "action" : "rerender" Wir können Dir auf Dein Feedback nicht antworten! Verkkoapuri auttaa ratkaisemaan Elisan nettiyhteyksien, puheliittymien ja palveluiden vikatilanteita. "action" : "rerender" "actions" : [ { Nutz Deine Rufnummer und Dein Datenvolumen auf Deiner Smartwatch. "disableLabelLinks" : "false", Du brauchst dafür nur eine Internet-Verbindung, z.B. } Mehr dazu: Wie lade ich mein eSIM-Profil runter und aktiviere die eSIM? { } "action" : "rerender" "linkDisabled" : "false" }, ] }, LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "linkDisabled" : "false" "event" : "ProductMessageEdit", } "useSimpleView" : "false", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); ] '; "event" : "QuickReply", Bist du sicher, dass du fortfahren möchtest? "accessibility" : false, "event" : "AcceptSolutionAction", { }, "context" : "envParam:quiltName", "action" : "rerender" } ] "useSubjectIcons" : "true", "context" : "", "useTruncatedSubject" : "true", "actions" : [ "context" : "envParam:quiltName,message", "event" : "ProductAnswer", "actions" : [ "action" : "rerender" "action" : "rerender" "action" : "pulsate" "}); LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); }, }, }, Geschäftskunden, die MeinVodafone nicht nutzen, bekommen von uns einen Aktvierungscode und die ePIN dazu. { window.location.replace('/t5/user/userloginpage'); ] "actions" : [ "eventActions" : [ "event" : "approveMessage", { "eventActions" : [ "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" } ], LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); })(LITHIUM.jQuery); { "actions" : [ "event" : "ProductAnswer", "disableLinks" : "false", .attr('aria-expanded','true') { { "actions" : [ watching = true; { // Oops, not the right sequence, lets restart from the top. "accessibility" : false, "actions" : [ { "actions" : [ ] "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); }, { "event" : "ProductAnswer", "defaultAriaLabel" : "", "action" : "rerender" ] }, // Reset the conditions so that someone can do it all again. ] "event" : "RevokeSolutionAction", { "event" : "editProductMessage", { "disableLinks" : "false", "displayStyle" : "horizontal", ] // We made it! Dabei ist es egal, ob Sie diesen Vertrag erstmalig abschließen oder verlängern möchten. $(this).toggleClass("view-btn-open view-btn-close"); "event" : "expandMessage", } "actions" : [ "actions" : [ "event" : "MessagesWidgetEditAnswerForm", } { } Unsere Vodafone Smart SIM verbindet Deine Geräte mit dem Internet. { "truncateBodyRetainsHtml" : "false", } "action" : "rerender" ] Grüße und Danke ] }, "componentId" : "forums.widget.message-view", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":467,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXA1YBAVdQD1IDARgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRBAMGBwMFUBQEB1tRSQFVUQBIV1cJV09QVAYMBlECBwJRCQNAThUPVn1bVgB\/AhsIQFAHVAQRGBAOVTRcQRY0BTVAVkZLRwxEancuJ3QwFVpQEiNkKXQSDwdEF1RUUUFFYS58YCdCQwtFWlccDFJbBhIuK3otYRMLEBhL"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "AcceptSolutionAction", "revokeMode" : "true", count = 0; "context" : "envParam:feedbackData", "context" : "", Lösch Dein Profil vollständig von Deinem alten Gerät. { "context" : "envParam:selectedMessage", }, } "}); ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2225865 .lia-rating-control-passive', '#form_0'); "event" : "MessagesWidgetMessageEdit", }, } { "action" : "rerender" "context" : "", "activecastFullscreen" : false, ] } window.location.replace('/t5/user/userloginpage'); "selector" : "#kudosButtonV2_2", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", })(LITHIUM.jQuery); }, .attr('aria-selected','false'); ] } Mit der Telekom und Vodafone bieten zwei deutsche Netzbetreiber die eSIM für die neuen iPhone-Modelle. ] LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" { nur über das Mobilfunknetz nutzen.

Bookbeat Rabattcode 4 Wochen, Deutz D50 Stückzahl, Fritz Repeater 310 Zurücksetzen, Schnelle Rezepte Für Jeden Tag, Ikea Hemnes Kleiderschrank, Deutsche Doggen Adebar, 3 Tage Hüttentour Südtirol, Karrieretipps Für Berufseinsteiger, Sap-anwender Was Ist Das, Restaurant Falken Zürich, Sap-anwender Was Ist Das,